HORDB

ID: hor001516
Uniprot ID: O44185
Protein name: SAAAPLIRF-amide
Gene name: flp-13
Organism: Caenorhabditis elegans
Family: FARP (FMRFamide related peptide) family
Source: animal
Expression: Expressed from the comma stage of embryogenesis, during all larval stages, and in low levels in adults . |Expressed in the ASE sensory neurons, the DD motor neurons, the 15, M3 and M5 cholinergic pharyngeal motoneurons, and the ASG, ASK and BAG neurons.
Disease: NA
Comments: NA
Taxonomy: Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0071855 neuropeptide receptor binding
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0045187 regulation of circadian sleep/wake cycle, sleep; GO:1900034 regulation of cellular response to heat
GO CC: GO:0005576 extracellular region

Sequence: SAAAPLIRF
Length: 9
Propeptide: MMTSLLTISMFVVAIQAFDSSEIRMLDEQYDTKNPFFQFLENSKRSDRPTRAMDSPLIRFGKRAADGAPLIRFGRAPEASPFIRFGKRAADGAPLIRFGRAPEASPFIRFGKRASPSAPLIRFGRSPSAVPLIRFGRSAAAPLIRFGRASSAPLIRFGRK
Signal peptide: MMTSLLTISMFVVAIQA
Modification: T9 Phenylalanine amide
Glycosylation: NA
Mutagenesis: NA

Function: Probable FMRFamide-like neuropeptides (PubMed:28094002, PubMed:16377032). Binds to neuronal receptors such as dmsr-1 to promote sleep in response to cellular stress also known as stress-induced sleep (SIS) (PubMed:28094002). Plays a role in behaviors associated with SIS, acting in concert with the FMRFamide related peptide, flp-24 and neuropeptide-like protein nlp-8 (PubMed:27546573).
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor001516_AF2.pdb

hor001516_ESM.pdb

Mass:	108801	Formula:	C44H72N12O11
Absent amino acids:	CDEGHKMNQTVWY	Common amino acids:	A
pI:	10.55	Basic residues:	1
Polar residues:	1	Hydrophobic residues:	6
Hydrophobicity:	106.67	Boman Index:	-7
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	120
Instability Index:	3028.89	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

PubMed ID: 16061202
Title: Discovering Neuropeptides in Caenorhabditis Elegans by Two Dimensional Liquid Chromatography and Mass Spectrometry.
PubMed ID: 16377032
Title: FMRFamide Related Peptide Ligands Activate the Caenorhabditis Elegans Orphan GPCR Y59H11AL.1